Recombinant Monkeypox virus L1R Protein C-10His

E.coli

Detects a band of approximately 19kD (Predicted molecular weight: 19.4kD)

Lyophilized Powder

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Protein sequence(Q8V4Z7, Met1-Gln152, with C-10*His)
MDHNQYLLTMFFADDDSFFKYFASQDDESSLSDILQITQYLDFLLLLLIQSKNKLEAVGHCYESLSEEYRQLTKFTDSQDFKKLFNKVPIVTDGRVKLNKGYLFDFVISLMRFKKESALATTAIDPVRYIDPRRDIAFSNVMDILKSNKVEQGGGGSHHHHHHHHHH

C-10His

＞95% by SDS-PAGE

unconjugated

Reconstitute no more than 0.1 mg/mL according to the size in deionized water after rapid centrifugation.

Within 1 month, 2 to 8 °C under sterile conditions after reconstitution. 12 months from date of receipt, -20 to -80 °C as supplied. Avoid repeated freeze-thaw cycles.

L1R is highly homologous to vaccinia virus protein J1R. Vaccinia virus contains a conserved J1R open reading frame that encodes a late protein of 17.8 kDa. The 18-kDa J1R protein is associated mainly with the membrane fraction of intracellular mature virus particles.

Q8V4Z7