Recombinant Human Estrogen Receptor β/ERβ/NR3A2 (N-6His)

Recombinant Human Estrogen Receptor Beta is produced by our E.coli expression system and the target gene encoding Met1-Ala323 is expressed with a 6His tag at the N-terminus.

Estrogen Receptor β蛋白, ERβ蛋白, NR3A2蛋白;Estrogen Receptor Beta, ER-Beta, Nuclear Receptor Subfamily 3 Group A Member 2, ESR2, ESTRB, NR3A2

Escherichia coli.

Lyophilized from a 0.2 μm filtered solution of 50mM TrisHCl，pH8.0.

MGSSHHHHHHSSGLVPRGSHMDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPA MTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEA RSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKR SIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQ

Greater than 90% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Estrogen Receptor Beta (ESR2) is a nuclear protein that belongs to the nuclear hormone receptor family of NR3 subfamily. It contains one nuclear receptor DNA-binding domain and is expressed in many tissues at a lower level. ESR2 is a nuclear hormone receptor. It binds estrogens with an affinity similar to that of ESR1 and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner. DNA-binding by ESR1 and ESR2 is rapidly lost at 37 degrees Celsius in the absence of ligand while in the presence of 17 beta-estradiol and 4-hydroxy-tamoxifen loss in DNA-binding at elevated temperature is more gradual.

Q92731-3